Gimars 40 Packs XL Large Disposable Travel Toilet Seat Covers - Individually Wrapped Portable Non Slip Waterproof Potty Seat Covers for Adult,Kids and Toddler Potty Training,Owl Design
$25.98
Features
[Extra Large Design (24 * 25in) Fully Covers The Toilet Seat Which Prevent Child From Touching Any Part Of The Toilet] Big enough to drape over the front and sides of any shaped toilet so kids' bottom, legs, clothing, and hands do not touch public restrooms. Great for potty training and keeping little hands from gripping the sides of the public toilet seats when we have to use public restrooms.
[Individually Wrapped Compact for Travel & Easy Carrying] These 40 packs potty shields come in discreet, individually wrapped and easy to open pouches, which could easily carry in the car, purse, diaper bag, pocket for travel use. Gimars portable Potty Seat Covers are convenient for adults, the pregnant, the elderly and toddlers' potty training, with more sanitary in public places use.
[Improved PET Stickers Stay in Place with No Residue] Our disposable seat covers for toilets adapt high-quality and unique 2 sticky PET tabs, which are easy to stick at the bottom to keep them in place, especially for toilets with auto flushing. Besides, you can place the cover on the disposable toilet seat and it won't move! Strong adhesion allows you to not worry that the cover will tear or slip when you sit on it. NOTICE: NOT FLUSHABLE.
[30g Thicker Non-woven Surface and Waterproof Plastic PE Back] Our potty covers are made of two layers of premium fabric. The front side with a pattern is made of skin-friendly and ultra-soft cotton - no irritating skin. While the backing has a plastic-type coating so any wetness that may be on the toilet seat will not come through (to the part you sit on). They are thick enough to provide a barrier between me and the toilet seat.
[Cute Pattern with 40 Packs Choice &Buy with Confidence] Choice of 2 cute pattern owl and green dot designs that your kids will love. These 40 individually packed potty seat covers consist of 2 PE zipper bags each with 20 PCS. 2 PE zipper bags are packed in one PP bag. More hygienic outer packaging, don't worry about running out soon. If you have any issue with the products, we will try our best to provide satisfied service for you within hours.
Details
kgfrveedhygesufrusgpubresrms?kfurherhGmrs40PksXrgeDspsberveeSevers!urexr-rgedesgfuyversheese,prevegyurhdfrmuhgyprfhee.Whhebydrpeverhefrdsdesfyshpede,heseseverskeepkds'bms,egs,hg,dhdsedgerm-free.Perfefrpyrgdvdghedrededgrppubeses.
Wheyu'reheg,urdvduywrppedseversrempfrrvedesyrry.Ehpyshedmesdsree,esy--pepuh,mkghembreezesreyurr,purse,dperbg,rpke.GmrsprbePySeversreyveefrdusdheedery,busfrdderswhrehemdsfpyrg.D'mprmsehygeewheusgpubpes-hseGmrs!
Weudersdhemprefseverssygpe,espeywhedegwhu-fushges.h'swhyurdspsbeseversfeuremprvedPEskershsyfrmypewhresdueefbehd.Smpyskheverhebmdresssuredhw'mve.hesrgdhesesuresheverw'errspwheyus,prvdgyuwhwrry-freeresrmexperee.Peseehheseseversrefushbe.
urpyversredesgedwhyurmfrdpremd.Mdewh30ghker-wvesurfe,heseseversffersfdushedfee.hefrsde,feurguewdgreeddesgs,smdefsk-fredydur-sfmerhw'rreyursk.hewerprfpsPEbkprvdesbrrerbeweeyudheese,esurgweessseepshrughhepryus.SyedmfrbewhGmrs!
Wh40pkshsefrm,yu'everruufdspsbesevers.urpkgeudes2ueperps,wdgreeds,hyurkdswve.Ehpksssf20dvduypkedpysevers,wh2pksveeypkedehygeuerbg.eedwrryburugus!Pus,yurssfsurprry.fyuhveyssueswhurprdus,urdededemwprvdeprmpdssfryservewhhurs.
kehesepwrdseerdmrehygeresrmexperee.D'seefresswhemespregyursefdyurfmyfrmgerms.hseGmrs40PksXrgeDspsberveeSeversdejyhepeefmdhmeswhusgurpremum-quy,dvduywrppedpysheds.Buywhfdeedsrprrzgyurhygeedy!
:
Discover More Best Sellers in Potty Training
Shop Potty Training
$19.19


$9.99


$9.99


$19.99


$31.99


$19.07


$15.95


Summer Infant My Travel Potty Waste Bags
$14.99


$29.99
