Gimars 40 Packs XL Large Disposable Travel Toilet Seat Covers - Individually Wrapped Portable Non Slip Waterproof Potty Seat Covers for Adult,Kids and Toddler Potty Training,Owl Design
$25.98
Features
[Extra Large Design (24 * 25in) Fully Covers The Toilet Seat Which Prevent Child From Touching Any Part Of The Toilet] Big enough to drape over the front and sides of any shaped toilet so kids' bottom, legs, clothing, and hands do not touch public restrooms. Great for potty training and keeping little hands from gripping the sides of the public toilet seats when we have to use public restrooms.
[Individually Wrapped Compact for Travel & Easy Carrying] These 40 packs potty shields come in discreet, individually wrapped and easy to open pouches, which could easily carry in the car, purse, diaper bag, pocket for travel use. Gimars portable Potty Seat Covers are convenient for adults, the pregnant, the elderly and toddlers' potty training, with more sanitary in public places use.
[Improved PET Stickers Stay in Place with No Residue] Our disposable seat covers for toilets adapt high-quality and unique 2 sticky PET tabs, which are easy to stick at the bottom to keep them in place, especially for toilets with auto flushing. Besides, you can place the cover on the disposable toilet seat and it won't move! Strong adhesion allows you to not worry that the cover will tear or slip when you sit on it. NOTICE: NOT FLUSHABLE.
[30g Thicker Non-woven Surface and Waterproof Plastic PE Back] Our potty covers are made of two layers of premium fabric. The front side with a pattern is made of skin-friendly and ultra-soft cotton - no irritating skin. While the backing has a plastic-type coating so any wetness that may be on the toilet seat will not come through (to the part you sit on). They are thick enough to provide a barrier between me and the toilet seat.
[Cute Pattern with 40 Packs Choice &Buy with Confidence] Choice of 2 cute pattern owl and green dot designs that your kids will love. These 40 individually packed potty seat covers consist of 2 PE zipper bags each with 20 PCS. 2 PE zipper bags are packed in one PP bag. More hygienic outer packaging, don't worry about running out soon. If you have any issue with the products, we will try our best to provide satisfied service for you within hours.
Details
kgfrveedhygesufrusgpubresrms?kfurherhGmrs40PksXrgeDspsberveeSevers!urexr-rgedesgfuyversheese,prevegyurhdfrmuhgyprfhee.Whhebydrpeverhefrdsdesfyshpede,heseseverskeepkds'bms,egs,hg,dhdsedgerm-free.Perfefrpyrgdvdghedrededgrppubeses.
Wheyu'reheg,urdvduywrppedseversrempfrrvedesyrry.Ehpyshedmesdsree,esy--pepuh,mkghembreezesreyurr,purse,dperbg,rpke.GmrsprbePySeversreyveefrdusdheedery,busfrdderswhrehemdsfpyrg.D'mprmsehygeewheusgpubpes-hseGmrs!
Weudersdhemprefseverssygpe,espeywhedegwhu-fushges.h'swhyurdspsbeseversfeuremprvedPEskershsyfrmypewhresdueefbehd.Smpyskheverhebmdresssuredhw'mve.hesrgdhesesuresheverw'errspwheyus,prvdgyuwhwrry-freeresrmexperee.Peseehheseseversrefushbe.
urpyversredesgedwhyurmfrdpremd.Mdewh30ghker-wvesurfe,heseseversffersfdushedfee.hefrsde,feurguewdgreeddesgs,smdefsk-fredydur-sfmerhw'rreyursk.hewerprfpsPEbkprvdesbrrerbeweeyudheese,esurgweessseepshrughhepryus.SyedmfrbewhGmrs!
Wh40pkshsefrm,yu'everruufdspsbesevers.urpkgeudes2ueperps,wdgreeds,hyurkdswve.Ehpksssf20dvduypkedpysevers,wh2pksveeypkedehygeuerbg.eedwrryburugus!Pus,yurssfsurprry.fyuhveyssueswhurprdus,urdededemwprvdeprmpdssfryservewhhurs.
kehesepwrdseerdmrehygeresrmexperee.D'seefresswhemespregyursefdyurfmyfrmgerms.hseGmrs40PksXrgeDspsberveeSeversdejyhepeefmdhmeswhusgurpremum-quy,dvduywrppedpysheds.Buywhfdeedsrprrzgyurhygeedy!
:
Discover More Best Sellers in Potty Training
Shop Potty Training
$19.19
Potty Training - Disney girls Princess Potty Training Pants Include Success Chart & Stickers of Cinderella, Belle, Moana & More 2t,3t,4t Sizes
$9.99
Potty Training - 120 Pieces Toilet Targets for Potty Training Boys Potty Targets for Boys Potty Training Aids Flushable Boys Pee Targets Potty Training Chart for Toddlers Boys Training Use Potty (Cars Styles)
$9.99
Potty Training - Nuby Disposable Travel Potty with Liner - Foldable and Portable Potty; Toddler Potty Essential for Camp, Trips, & Car Rides - Travel Potty for Toddler, 2 Pack
$19.99
Potty Training - Kosiz 50 Pcs Toilet Seat Covers Disposable Extra Large Toddler Toilet Covers for Kids Adults in Public Restroom, Individually Wrapped Portable Toddler Potty Training Toilet Seat Covers (Mermaid)
$31.99
Potty Training - Sesame Street Elmo Hooray! 3-in-1 Potty Chair, Toilet Trainer, and Step Stool, Pretend Flush Handle, Gender Neutral Toddler Potty for Boys & Girls - Blue
$19.07
Potty Training - ECO BOOM Toddler Potty Training Pants, Bamboo Viscose Materials, Hypoallergenic for Sensitive Skin, Eco Friendly Pull Ups for Boys and Girls, Size 4 Suitable for 20 to 31lb (L - 24 Count)
$15.95
Potty Training - 20 Pack Extra Large Disposable Toilet Seat Covers (Floral) by Eli with Love – Toddler Toilet Covers For Full Coverage On Toilet or Potty – Ideal Travel Toilet Seat Covers For Both Kids and Adults
Summer Infant My Travel Potty Waste Bags
$14.99
Potty Training - Summer Infant My Travel Potty Waste Bags
$29.99
Potty Training - Potty Training Toilet Seat with Step Stool Ladder for Boys and Girls,Toddler Kid Children Toilet Training Seat Chair with Handles,Height Adjustable,Non-Slip Wide Step(Pink)

